PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID BGIOSGA001434-PA
Common NameOsI_02388
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family Nin-like
Protein Properties Length: 407aa    MW: 44459.5 Da    PI: 6.8611
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA001434-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK85.54.8e-27250299352
            RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                       ++i +edl++yF++pi++AA+e++v+lTvLK++CR++G++RWPhRk+ksl
  BGIOSGA001434-PA 250 DHIGFEDLRRYFYMPITKAAREMNVGLTVLKKRCRELGVARWPHRKMKSL 299
                       6899********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.496239319IPR003035RWP-RK domain
PfamPF020423.3E-21252299IPR003035RWP-RK domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 407 aa     Download sequence    Send to blast
MHECCYYGGS IGGDWLNPLA AIPPPCSSSS SSWSSQLLLL RDEEMEMAAG YLPVAASAAA  60
AADVDHYVYQ QFQLEPDQFV STLPAVAVAV AATAGGGSHD DELLRMPFTD IDLDAFADAR  120
DVVVGVGEPK PSPQHTLDAA IALTAVGGGG AHHFGTQDDD VKFDVTKQRN DAALAGDDSL  180
SMVIVESYEM GMRRHAAEQE QEQKPKIITS AATTLTPLPL PPPPPPPPRV TRSRRDGSSA  240
ATAGGKTRLD HIGFEDLRRY FYMPITKAAR EMNVGLTVLK KRCRELGVAR WPHRKMKSLK  300
SLILNEMGSK GMSAAAMRRE LEALENCCAL MERNPAVELT ERTKKLRQAC FKENYKRRRA  360
AAVDVLDLDH CFSFAAGHCH HHHHQQLALP PPPAAAADHR RRDFFGY
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0039330.0AP003933.4 Oryza sativa Japonica Group genomic DNA, chromosome 1, BAC clone:OSJNBa0066C06.
GenBankAP0042580.0AP004258.3 Oryza sativa Japonica Group genomic DNA, chromosome 1, BAC clone:OSJNBa0024F24.
GenBankAP0149570.0AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
GenBankCP0126090.0CP012609.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015638205.10.0PREDICTED: uncharacterized protein LOC107276829
TrEMBLB8AA170.0B8AA17_ORYSI; Putative uncharacterized protein
STRINGBGIOSGA001434-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP128882330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53040.13e-31RWP-RK domain-containing protein